PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10009996
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 282aa    MW: 31990.7 Da    PI: 8.1057
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10009996genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.42.2e-153380148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l+++v+++G g W++ ar  g++R +k+c++rw +yl
      Lus10009996 33 KGPWTAEEDSILANYVALHGEGYWNAAARSSGLKRIGKSCRLRWMNYL 80
                     79********************************************97 PP

2Myb_DNA-binding461.2e-1486129146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T  E++l+++++ ++G++ W++Ia+ ++ gRt++++k++w++
      Lus10009996  86 RGNITLHEQLLILQLHSRWGNR-WSKIAEQLP-GRTDNEIKNYWRT 129
                      7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.842880IPR017930Myb domain
SuperFamilySSF466892.16E-2831127IPR009057Homeodomain-like
SMARTSM007172.2E-103282IPR001005SANT/Myb domain
PfamPF002492.5E-133380IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-193487IPR009057Homeodomain-like
CDDcd001671.59E-73580No hitNo description
PROSITE profilePS5129421.69481135IPR017930Myb domain
SMARTSM007175.0E-1385133IPR001005SANT/Myb domain
PfamPF002495.4E-1386129IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2188133IPR009057Homeodomain-like
CDDcd001672.35E-990129No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MDGRLENIHF MMSYDRNHSD EGQYSGSRST VKKGPWTAEE DSILANYVAL HGEGYWNAAA  60
RSSGLKRIGK SCRLRWMNYL RPNVRRGNIT LHEQLLILQL HSRWGNRWSK IAEQLPGRTD  120
NEIKNYWRTR VQKLAKQLNC EVSSARFRDA MHYDWIPRLI ERIQSSTTPK LPHHQPTSSP  180
SLHFRDTESN NSVGSASTYN NNIVDIVNRD KVANMSLSLE WQATSSNSAS SDSFDSMASL  240
DFGAKNYGGG CSKAVVVEEQ SPPWETLEDS IWLALENDLL L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-2333127497MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011002746.12e-81PREDICTED: transcription factor MYB108-like
TrEMBLG7ICT93e-79G7ICT9_MEDTR; MYB3
STRINGSi030584m1e-73(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87534125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47190.12e-71myb domain protein 2